ANTIBODIES

Contributor Information
- Name Arnoud Sonnenberg
- Institute Netherlands Cancer Institute
Tool Details
- Tool name: Anti-Integrin a-3B [54B3]
- Alternate names: ITGA3; Antigen CD61
- Tool type: Antibodies
- Tool sub-type: Primary antibody
- Class: Monoclonal
- Conjugate: Unconjugated
- Reactivity: Human
- Host: Mouse
- Application: IHC ; WB
- Strain: Balb/c
- Description: ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the ÄÂ?3ÄÂ?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
- Immunogen: A mouse was immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin a3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
- Isotype: IgG1
- Research area: Cell biology; Cell signaling and signal transduction
- Myeloma used: Sp2/0-Ag14
- For Research Use Only
Target Details
- Target: Integrin a3B
- Target background: ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the a3?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
Application Details
- Application: IHC ; WB
Handling
- Format: Liquid
- Concentration: 0.9-1.1 mg/ml
- Storage buffer: PBS with 0.02% azide
- Storage conditions: -15ðC to -25ðC
- Shipping conditions: Shipping at 4ðC
References
- • de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.