Product Image

Contributor Information

  • Institute BioServ UK Ltd

Tool Details

  • Tool name: Anti-Growth Differentiation Factor 9 [53/1]
  • Alternate names: Growth/differentiation factor 9, GDF-9, GDF9
  • Clone: 53/1
  • Tool type: Antibodies
  • Tool sub-type: Primary antibody
  • Class: Monoclonal
  • Conjugate: Unconjugated
  • Reactivity: Human
  • Host: Mouse
  • Molecular weight of the target: 17.5 kDa
  • Application: ELISA ; IHC ; WB
  • Strain: Balb/c
  • Description: GDF9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
  • Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
  • Isotype: IgG1
  • Research area: Cell signaling and signal transduction
  • Myeloma used: Sp2/0-Ag14

  • For Research Use Only

Target Details

  • Target: Growth Differentiation Factor 9
  • Target molecular weight: 17.5 kDa
  • Target background: GDF9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Application Details

  • Application: ELISA ; IHC ; WB

Handling

  • Format: Liquid
  • Shipping conditions: Shipping at 4°C

Documentation

Related Tools

Product Image

Anti-Polycystin-1 (human) [7.00E+12]

#156645
Product Image

Anti-CEACAM6 (CD66c) [1H7-4B]

#153324
Product Image

Anti-Testosterone [3T16] mAb

#151051

References

  • •  Li et al. 2015. Mol Endocrinol. 29(1):40-52. PMID: 25394262.
  • •  Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.
  • •  Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.
  • •  Aberrant GDF9 expression and activation are associated with common human ovarian disorders.
  • •  Simpson et al. 2012. Endocrinology. 153(3):1301-10. PMID: 22234469.
  • •  Activation of latent human GDF9 by a single residue change (Gly 391 Arg) in the mature domain.
  • •  Mottershead et al. 2008. Mol Cell Endocrinol. 283(1-2):58-67. PMID: 18162287.
  • •  Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.
  • •  Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.
  • •  Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.