PROTEINS
Contributor Information
- Name Dr. Alistair K. Brown
- Institute The University of Newcastle Upon Tyne
- Primary citation Kremer et al. 2011. Journal of Biological Chemistry. 276(30):27967-74. PMID: 11373294
Tool Details
- Tool name: Recombinant holo-Acyl carrier protein (holo-AcpM) from Mycobacterium tuberculosis (tagged)
- Tool type: Protein
- Tool sub-type: Carrier protein
- Sequence: MGSSHHHHHHSSGLVPRGSHMPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK
- Source: Mycobacterium tuberculosis (tagged)
- Molecular weight of the target: Holo-AcpP Mw (with His6-tag): 15027.28
- Description: Activated recombinant AcpM from Mycobacterium tuberculosis (cleavable tag) expressed in an E.coli BL21(DE3) derivative. N-terminal His6-tagged thrombin cleavable (underlined) AcpM.
- For Research Use Only
Related Tools
References
- • Kremer et al. 2011. Journal of Biological Chemistry. 276(30):27967-74. PMID: 11373295