PROTEINS

Contributor Information
- Name Natasa Skoko
- Institute International Centre For Genetic Engineering And Biotechnology (ICGEB)
Tool Details
- Tool name: Human Insulin (INS), Recombinant Protein
- Alternate names: Insulin, INS
- Tool type: Proteins
- Tool sub-type: Cytokine
- Sequence: B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT A chain: GIVEQCCTSICSLYQLENYCN
- Cellular/ tissue localisation: Beta cells of Pancreatic Islets
- Source: Pichia pastoris
- Expression system: Recombinant
- UniProt ID: P01308
- Description: Two-chain polypeptide hormone produced by the ß-cells of pancreatic islets. The a and ß chains are joined by two interchain disulfide bonds. The a chain contains an intrachain disulfide bond. Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat. Serum-free medium supplements such as insulin are essential for long-term growth of commonly used mammalian cell lines. When insulin is absent from media, cell may exhibit disturbances in morphology and growth rate.
- Research area: Cell signaling and signal transduction; Metabolism
- Animal free: Yes
- Additional notes: Human recombinant insulin is identical in function and structure to the native human sequence. A hormone consisting of two polypeptide chains, Insulin's A-chain (21 amino acids) and B-chain (30 amino acids) are covalently linked by disulfide bonds between cysteine residues. Molecular Weight: ~5.8 kDa UniProt number P01308
- For Research Use Only
Target Details
Application Details
- Application notes: Human recombinant insulin is identical in function and structure to the native human sequence. A hormone consisting of two polypeptide chains, Insulinâ˛s A-chain (21 amino acids) and B-chain (30 amino acids) are covalently linked by disulfide bonds between cysteine residues. Molecular Weight: ~5.8 kDa UniProt number P01308
Handling
- Storage conditions: -20°C
- Shipping conditions: Dry Ice