Product Image

Contributor Information

  • Name Arnoud Sonnenberg
  • Institute Netherlands Cancer Institute

Tool Details

  • Tool name: Anti-Integrin a-3A [29A3]
  • Alternate names: ITGA3; Antigen CD49C
  • Tool type: Antibodies
  • Tool sub-type: Primary antibody
  • Class: Monoclonal
  • Conjugate: Unconjugated
  • Reactivity: Human
  • Host: Mouse
  • Application: IHC ; WB
  • Strain: Balb/c
  • Description: ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the Î?3Î?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
  • Immunogen: A mouse was immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
  • Isotype: IgG1
  • Research area: Cell biology; Cell signaling and signal transduction
  • Myeloma used: Sp2/0-Ag14

  • For Research Use Only

Target Details

  • Target: Integrin a3A
  • Target background: ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the a3?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.

Application Details

  • Application: IHC ; WB

Handling

  • Format: Liquid
  • Concentration: 0.9-1.1 mg/ml
  • Storage buffer: PBS with 0.02% azide
  • Storage conditions: -15°C to -25°C
  • Shipping conditions: Shipping at 4°C

Documentation

References

  •   de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.
  •   Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.