Product Image

Contributor Information

  • Institute BioServ UK Ltd

Tool Details

  • Tool name: Anti-Activin C [BetaC1]
  • Alternate names: Activin beta-C chain, Inhibin beta C chain
  • Clone: BetaC1
  • Tool type: Antibodies
  • Tool sub-type: Primary antibody
  • Class: Monoclonal
  • Conjugate: Unconjugated
  • Reactivity: Human
  • Host: Mouse
  • Application: IHC ; WB
  • Strain: Balb/c
  • Description: Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The Î?-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. Î?-C Clone 1 recognizes the Î?-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.
  • Immunogen: Synthetic peptide sequence VPTARRPLSLLYYDRDSNIKVTDIPMVVEAC which recognizes amino acids 82-113 of human Activin ? -C subunit
  • Isotype: IgG1
  • Research area: Cancer; Immunology
  • Myeloma used: Sp2/0-Ag14

  • For Research Use Only

Target Details

  • Target: Activin C
  • Target background: Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The ?-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. ?-C Clone 1 recognizes the ?-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.

Application Details

  • Application: IHC ; WB

Handling

  • Format: Liquid
  • Shipping conditions: Shipping at 4°C

Documentation

Related Tools

Product Image

Anti-CD43 (rat) [OX75]

#156601
Product Image

Anti-HDAC6-D1 (236) mouse (D1 domain-specific)

#157673
Product Image

Anti-S. pneumoniae serotype 5 capsule (polysaccharide) [5F6]

#153697

References

  • •  Gold et al. 2005. J Mol Endocrinol. 34(2):505-15. PMID: 15821113.
  • •  betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.
  • •  Mellor et al. 2003. Endocrinology. 144(10):4410-9. PMID: 12960042.
  • •  Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.
  • •  Mellor et al. 2000. J Clin Endocrinol Metab. 85(12):4851-8. PMID: 11134153.
  • •  Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.